PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Solyc06g061080.2.1
Common NameLOC101244385
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family NAC
Protein Properties Length: 338aa    MW: 38107.6 Da    PI: 5.7791
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Solyc06g061080.2.1genomeITAGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM174.14e-5461331128
                 NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.k.kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkd 89 
                         lppGfrFhPtd+elv +yLk+k+++ ++el evi+ +d+yk++PwdLp k  + +++ ewyfF++rdkky++g+r+nrat+sgyWkatgkd
  Solyc06g061080.2.1   6 LPPGFRFHPTDQELVGYYLKRKTDELEIEL-EVIPVIDLYKFDPWDLPeKsFLPKRDMEWYFFCSRDKKYPNGSRTNRATNSGYWKATGKD 95 
                         79****************************.99**************95344555788********************************* PP

                 NAM  90 kevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                         k+v++ k+++vg +ktLvfy+grap g +tdWvmheyrl
  Solyc06g061080.2.1  96 KKVVC-KSAVVGYRKTLVFYRGRAPLGDRTDWVMHEYRL 133
                         *****.999****************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.22E-614156IPR003441NAC domain
PROSITE profilePS5100557.9286156IPR003441NAC domain
PfamPF023651.7E-297133IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 338 aa     Download sequence    Send to blast
MAGISLPPGF RFHPTDQELV GYYLKRKTDE LEIELEVIPV IDLYKFDPWD LPEKSFLPKR  60
DMEWYFFCSR DKKYPNGSRT NRATNSGYWK ATGKDKKVVC KSAVVGYRKT LVFYRGRAPL  120
GDRTDWVMHE YRLCDDVSQG TPSFQGPFAL CRVIKRKDNI PSKTSDVHGG TVFKQVECSS  180
SIEGFTSTVA LNEPLLLSND MPTPSTYMSG NSNYSTPTNS PYKITQIEDY DSANLWMPQN  240
KVLDPSKECP QGRSISGNYP HMFSNSTSWQ PSDQYDFTSS SSFPNFRGEV ELSGDLSGYG  300
NVSPFSVDGS CMEFYGSGEI SYKGYNQNDL LGNPYLF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4dul_B4e-51115912168NAC domain-containing protein 19
4dul_A4e-51115912168NAC domain-containing protein 19
1ut7_B4e-51115912168NO APICAL MERISTEM PROTEIN
1ut7_A4e-51115912168NO APICAL MERISTEM PROTEIN
1ut4_B4e-51115912168NO APICAL MERISTEM PROTEIN
1ut4_A4e-51115912168NO APICAL MERISTEM PROTEIN
3swp_D5e-51115915171NAC domain-containing protein 19
3swp_C5e-51115915171NAC domain-containing protein 19
3swp_B5e-51115915171NAC domain-containing protein 19
3swp_A5e-51115915171NAC domain-containing protein 19
3swm_D5e-51115915171NAC domain-containing protein 19
3swm_C5e-51115915171NAC domain-containing protein 19
3swm_B5e-51115915171NAC domain-containing protein 19
3swm_A5e-51115915171NAC domain-containing protein 19
3ulx_A5e-51213311140Stress-induced transcription factor NAC1
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Les.70871e-119callus| fruit| root
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKC1583080.0Solanum lycopersicum AFLP fragment TGG2, mRNA sequence
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004241972.10.0PREDICTED: NAC domain-containing protein 86-like
SwissprotA4VCM02e-70NAC45_ARATH; NAC domain-containing protein 45
TrEMBLK4C6T80.0K4C6T8_SOLLC; Uncharacterized protein
STRINGSolyc06g061080.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA62561635
Representative plantOGRP1715800
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G46590.14e-77NAC domain containing protein 96
Publications ? help Back to Top
  1. Wang Y,van der Hoeven RS,Nielsen R,Mueller LA,Tanksley SD
    Characteristics of the tomato nuclear genome as determined by sequencing undermethylated EcoRI digested fragments.
    Theor. Appl. Genet., 2005. 112(1): p. 72-84
    [PMID:16208505]